Quick Facts
| Peptide name | LL-37 |
|---|---|
| Research category | Immunity |
| Molecular formula | C₂₀₅H₃₄₀N₆₀O₅₃ |
| Molecular weight | ≈ 4493 g/mol |
| Sequence | [LL-37, 37 aa] (37 residues) |
| Primary research interest | Host-defense antimicrobial activity and immunomodulatory signaling |
| Storage considerations | Lyophilized powder stored frozen at −20 °C; reconstituted solution refrigerated at 2–8 °C and protected from light. |
| Solubility notes | Soluble in sterile water; the amphipathic, cationic helix is sensitive to high-salt buffers, which can reduce antimicrobial activity in assays. |
| Related compounds | KPV, Thymosin Alpha-1, VIP |
Introduction
Research Use Only
LL-37 is discussed here strictly as an investigational research compound for educational and laboratory reference. It is not guidance for human use, diagnosis, treatment, or prevention of disease.
LL-37 is a 37-amino-acid antimicrobial peptide and the only member of the cathelicidin family found in humans. It is generated by cleavage of the precursor protein hCAP18 and takes its name from the two leucine residues at its N-terminus. In research, LL-37 is a centerpiece of the study of innate immunity — the rapid, non-specific first line of host defense — because it combines direct antimicrobial action with a wide range of immune-signaling roles.
What makes LL-37 distinctive among the peptides catalogued in the peptide database is that it is not a synthetic analogue or a fragment of a hormone but a genuine human host-defense molecule. It is studied alongside other immunomodulatory peptides such as Thymosin Alpha-1 and the anti-inflammatory tripeptide KPV, but its mechanism is rooted in membrane biophysics and chemotactic signaling rather than classical hormone-receptor pathways.
This profile covers what LL-37 is, the cathelicidin biology behind it, its molecular and structural characteristics, its dual antimicrobial and immunomodulatory mechanisms, the host-defense and wound research contexts it appears in, and how it compares with related peptides. It also notes the important double-edged role LL-37 plays in inflammation research.
What is LL-37?
LL-37 is the mature antimicrobial peptide released when the precursor hCAP18 is processed, most notably by the protease proteinase-3 in neutrophils. It is produced by neutrophils, epithelial cells of the skin and mucosa, and other cell types, and its expression rises in response to infection and injury. As a host-defense peptide, it is part of the same broad functional category as the defensins, though it is structurally and mechanistically distinct.
The molecule is cationic (net positive charge from its many lysine and arginine residues) and amphipathic (segregating hydrophobic and hydrophilic faces when folded into a helix). These two properties are the foundation of its antimicrobial action: the positive charge draws it to the negatively charged surfaces of microbial membranes, and the amphipathic helix allows it to insert into and disrupt those membranes.
At a glance
Class: human cathelicidin antimicrobial peptide (the only one in humans). Origin: cleaved from the hCAP18 precursor. Key properties: cationic, amphipathic α-helix. Research focus: broad antimicrobial activity plus immunomodulation, chemotaxis, and wound responses.
Molecular and structural characteristics
In aqueous solution LL-37 is largely unstructured, but on contact with lipid membranes or under physiological ionic conditions it folds into an amphipathic α-helix. This conformational switch is central to its function: the folded helix presents a hydrophobic surface that engages membrane lipids and a cationic surface that anchors it to anionic phospholipids and bacterial components such as lipopolysaccharide (LPS).
A practical consideration in LL-37 research is its salt sensitivity: high ionic strength can shield the electrostatic attraction to microbial membranes and reduce measured antimicrobial potency, so assay conditions strongly influence reported activity. The peptide also tends to oligomerize, which affects both its membrane activity and its resistance to proteolysis.
| Property | Value / description |
|---|---|
| Peptide class | Human cathelicidin antimicrobial peptide |
| Length | 37 amino acids |
| Precursor | hCAP18 (cleaved by proteinase-3) |
| Net charge | Cationic (+6 region) |
| Secondary structure | Amphipathic α-helix on membrane contact |
| Molecular weight | ≈ 4493 g/mol |
Mechanism of action
LL-37's first and most direct mechanism is antimicrobial membrane disruption. Drawn by electrostatic attraction to the anionic surfaces of bacteria, fungi, and some enveloped viruses, the amphipathic helix inserts into the membrane and destabilizes it, often described through carpet- or toroidal-pore models. The result is loss of membrane integrity and microbial death, and the broad, membrane-based nature of this action is one reason resistance is harder to develop than against many small-molecule agents.
Beyond killing microbes directly, LL-37 acts as an immunomodulator. It is chemotactic for neutrophils, monocytes, mast cells, and T cells — recruiting immune cells to sites of infection — and signals through the formyl peptide receptor 2 (FPR2/ALX) and other receptors. It also neutralizes LPS, helping to limit excessive endotoxin-driven inflammation, and influences angiogenesis and re-epithelialization in wound contexts.
Importantly, LL-37 is a double-edged molecule in research. While it supports host defense, it can also amplify inflammation: in conditions such as psoriasis it has been studied as a factor that complexes with self-DNA/RNA to activate plasmacytoid dendritic cells, and it appears in autoimmune-disease research as a potential driver of inappropriate immune activation. This dual nature is a defining theme of the literature.
- Direct membrane disruption of bacteria, fungi, and some viruses.
- Chemotaxis and recruitment of neutrophils, monocytes, and T cells.
- Signaling through FPR2/ALX and related receptors.
- Neutralization of bacterial LPS (endotoxin).
- Context-dependent pro-inflammatory activity in autoimmune research.
Host-defense and antimicrobial research
The core research context for LL-37 is innate antimicrobial defense. Studies have associated it with activity against a broad spectrum of microorganisms, including Gram-positive and Gram-negative bacteria and certain fungi and viruses. Because its mechanism targets the physical membrane rather than a specific protein, it is of particular interest in the study of antibiotic-resistant organisms, where membrane-active strategies are an active research direction.
LL-37 expression at epithelial surfaces — skin, airway, and gut — is studied as part of the body's barrier immunity. Reduced cathelicidin activity has been associated in research with susceptibility to certain infections, while its regulation by factors such as vitamin D signaling is a well-documented area of innate-immunity study. These themes connect LL-37 to other peptides studied at the immunity interface, including Thymosin Alpha-1.
Evidence caveat
Antimicrobial potency reported for LL-37 is highly dependent on assay conditions, particularly salt concentration. Findings are described here as research observations rather than clinical outcomes.
Wound-healing and immunomodulation research
A second research theme is wound healing and tissue repair. LL-37 is studied for associations with keratinocyte migration, angiogenesis, and re-epithelialization, processes that overlap with the recruitment and signaling functions of its immunomodulatory role. In this context it is sometimes discussed alongside tissue-recovery peptides catalogued in the peptide database, though its proposed mechanisms differ from growth-factor-based approaches.
The same immunomodulatory breadth that makes LL-37 attractive in host-defense and wound research also underlies caution: its capacity to amplify inflammatory and autoimmune signaling means researchers study both its protective and its potentially harmful roles. This balance — antimicrobial and reparative on one hand, pro-inflammatory on the other — is what makes LL-37 a continually active subject in immunology.
Comparison: LL-37 vs KPV vs Thymosin Alpha-1
LL-37 is often considered alongside KPV, an α-MSH-derived anti-inflammatory tripeptide, and Thymosin Alpha-1, a thymic immunomodulatory peptide. All three appear in immunity research, but they occupy different niches.
| Compound | Class | Primary proposed mechanism | Main research context |
|---|---|---|---|
| LL-37 | Human cathelicidin antimicrobial peptide | Membrane disruption + immunomodulation | Host defense, wound healing, autoimmunity |
| KPV | α-MSH-derived tripeptide | NF-κB inhibition | Mucosal and skin inflammation |
| Thymosin Alpha-1 | Thymic immunomodulatory peptide | T-cell / innate immune modulation | Immune regulation |
Where KPV and Thymosin Alpha-1 are primarily studied for tuning the immune response, LL-37 uniquely combines a direct antimicrobial action with immunomodulation. Full entries for each are in the peptide database.
Half-life and pharmacokinetic considerations
As a natural peptide, LL-37 is subject to proteolytic degradation, and its activity in vivo is shaped by local protease activity, binding to host proteins, and the ionic environment. Its oligomerization is studied as a feature that can protect it from some proteases while also influencing its membrane activity. These factors make systemic half-life a difficult, context-dependent parameter rather than a single fixed value.
Much LL-37 research therefore emphasizes local concentrations at epithelial and inflammatory sites rather than systemic exposure. Reported activity is strongly dependent on the experimental setting — particularly salt concentration and the presence of competing host molecules — and these conditions are always noted when interpreting results.
Reconstitution and handling considerations
Lyophilized LL-37 is reconstituted with sterile water, added slowly down the vial wall and swirled gently rather than shaken. Because the peptide's antimicrobial activity is salt-sensitive, researchers select diluents appropriate to the assay; the reconstituted solution should be clear, and cloudiness or particulates indicate it should be discarded.
Working concentrations are chosen so research volumes are convenient and reproducible. The reconstitution calculator and reconstitution guide describe the general method.
- Add diluent slowly; swirl gently rather than shaking.
- Choose a diluent appropriate to the assay (salt affects activity).
- Confirm the solution is clear before use.
- Avoid repeated freeze–thaw cycles of reconstituted material.
Storage considerations
Lyophilized LL-37 is most stable frozen at −20 °C, kept dry and away from light. Once reconstituted, it is refrigerated at 2–8 °C and used within a limited window; aliquoting reduces how often a given solution is cycled through freeze–thaw, which is important for a peptide whose conformation and oligomeric state affect activity.
| Form | Condition | Notes |
|---|---|---|
| Lyophilized powder | −20 °C, dark, dry | Most stable for long-term holding |
| Reconstituted solution | 2–8 °C, protected from light | Use within a limited window |
| Freeze–thaw | Avoid repeated cycles | Aliquot to minimize cycling |
Research limitations
LL-37 is a research compound with a complex, sometimes contradictory profile. Its antimicrobial potency is highly assay-dependent, its immunomodulatory effects can be either protective or pro-inflammatory depending on context, and its role in autoimmune disease research is a cautionary one. Much data come from in-vitro systems, and translation to humans is not established. It is described here strictly for research reference.
- Antimicrobial activity is strongly affected by salt and assay conditions.
- Immunomodulatory effects are context-dependent (protective vs pro-inflammatory).
- It has been studied as a potential driver of autoimmune inflammation.
- It is not an approved therapy and is described solely for research reference.
Research Use Only
This profile is for educational and laboratory reference. LL-37 is not intended for human consumption, diagnosis, treatment, or prevention of disease.
Frequently Asked Questions
What is LL-37?
LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid molecule cleaved from the precursor hCAP18. It is produced by neutrophils and epithelial cells and is a central subject in innate-immunity research for its combined antimicrobial and immunomodulatory roles.
How does LL-37 kill microbes?
It is cationic and amphipathic, so it is drawn to the negatively charged surfaces of microbial membranes and folds into a helix that inserts into and disrupts them. This membrane-based mechanism is broad-spectrum and is studied as harder for microbes to develop resistance against than many small-molecule agents.
What does LL-37 do besides antimicrobial activity?
It acts as an immunomodulator: it recruits immune cells (chemotaxis), signals through receptors such as FPR2/ALX, neutralizes bacterial LPS, and influences angiogenesis and wound re-epithelialization. These functions place it at the center of innate immunity research.
Why is LL-37 called double-edged?
While it supports host defense and repair, LL-37 can also amplify inflammation. In conditions such as psoriasis it has been studied as a factor that activates immune cells through complexes with self-nucleic acids, so research examines both its protective and potentially harmful roles.
How robust is the LL-37 evidence base?
Cathelicidin biology is well studied, but LL-37's reported activity is highly dependent on experimental conditions — especially salt concentration — and much data come from in-vitro models. Findings should be read as research observations rather than clinical outcomes.
Related Research Profiles
KPV
KPV is a C-terminal tripeptide fragment of alpha-melanocyte-stimulating hormone (α-MSH) studied in preclinical models for its association with anti-inflammatory and immunomodulatory signaling, particularly in mucosal and skin tissue.
Read profileThymosin Alpha-1
Thymosin Alpha-1 is a 28-amino-acid thymic peptide studied extensively in immunological research for its association with T-cell maturation, dendritic-cell activation, and Toll-like-receptor-mediated immune modulation.
Read profileVIP (Vasoactive Intestinal Peptide)
VIP is a 28-amino-acid neuropeptide of the secretin/glucagon superfamily studied in preclinical research for its association with anti-inflammatory immune signaling, vasodilation, and neuroendocrine regulation.
Read profileReferences
- Dürr UH, Sudheendra US, Ramamoorthy A. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim Biophys Acta. 2006.Source
- Vandamme D, et al. A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cell Immunol. 2012.Source
- Kahlenberg JM, Kaplan MJ. Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J Immunol. 2013.Source
Research Use Only
For research use only. Not intended for human consumption, diagnosis, treatment, or prevention of disease. The information on this page is provided for educational and laboratory reference purposes only.
